missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13132-25mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15962599

Menge Preis
1 706.22 CHF / 25 Milligramm
5 651.14 CHF / 25 Milligramm
Voraussichtliches Versanddatum: 03-11-2021

Zum Warenkorb hinzufügen


Beschreibung

Beschreibung

Spezifikation

Spezifikation

Pramlintide Protein
25 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate