missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Pramlintide Protein
A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13132-25mg
Informations supplémentaires : Gewicht : 0.01000kg
Spécification
| Pramlintide Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 | |
| Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| 25 mg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Other | |
| Untagged | |
| The protein was lyophilized with no additives. |