missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL 17 A/F Protein

A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12392-2ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15970269

  • 131.00 CHF / 2 Mikrogramm
Verfügbar ab: 26-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Spezifikation

Spezifikation

IL 17 A/F Protein
Research Use Only
Recombinant Protein
E. coli
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Greater than 97.0% as determined by SDS-PAGE.
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Mouse
Untagged
Lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote