missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13450-1mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15983599

  • 2765.00 CHF / 1 Milligramm


Verfügbar ab
28-10-2020
Zum Warenkorb hinzufügen

Spezifikation

Spezifikation

SELE Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.
Greater than 95% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
HEK 293
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Videos
Dokumentation