missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human RB1 Protein
A cDNA sequence encoding the RB1 was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP13275-1mg
Additional Details : Gewicht : 0.01000kg
Spezifikation
RB1 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH 7.4. |