missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human RB1 Protein

A cDNA sequence encoding the RB1 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13275-1mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15983049

  • 2490.00 CHF / 1 Milligramm


Verfügbar ab
28-10-2020
Zum Warenkorb hinzufügen

Spezifikation

Spezifikation

RB1 Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH 7.4.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
Videos
Dokumentation