missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human RAC1 Protein

A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13249-10ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15962969

Menge Preis
1 128.22 CHF / 10 Mikrogramm
10 117.77 CHF / 10 Mikrogramm
Voraussichtliches Versanddatum: 02-11-2021

Zum Warenkorb hinzufügen


Beschreibung

Beschreibung

Spezifikation

Spezifikation

RAC1 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate