missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PROC Protein

A cDNA sequence encoding the PROC was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13151-2ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15972659

  • 131.00 CHF / 2 Mikrogramm
Verfügbar ab: 26-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Spezifikation

Spezifikation

5624
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
Human (HEK293)
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHHThe first 32 amino acids are predicted as signal peptide
Greater than 80.0% as determined by SDS-PAGE.
PROC Protein
Research Use Only
PROC
Human
His
PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote