missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human En Protein

A cDNA sequence encoding the En was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP10586-100ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15964328

Menge Preis
1 1402.10 CHF / 100 Mikrogramm
3 1291.90 CHF / 100 Mikrogramm
Voraussichtliches Versanddatum: 02-11-2021

Zum Warenkorb hinzufügen


Beschreibung

Beschreibung

Spezifikation

Spezifikation

2022
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
ENG
Recombinant Protein
Insect
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLID ANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPL ASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNI LSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSE FLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPI PKTGTLSCTVALRPKTGS
En Protein
100 μg
< 1.0 EU per ug protein as determined by the LAL method.
Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Human
His
Endoglin was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate