missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 11 Protein

A cDNA sequence encoding the HPV 11 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12306-100ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15969998

  • 227.00 CHF / 100 Mikrogramm
Verfügbar ab: 26-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Spezifikation

Spezifikation

HPV HPV 11 Protein
Research Use Only
Recombinant Protein
E. coli
VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote