missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 gp41 Long Protein

A cDNA sequence encoding the HIV-1 gp41 Long was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12250-EC-1mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15969828

  • 1735.00 CHF / 1 Milligramm
Verfügbar ab: 26-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Spezifikation

Spezifikation

HIV-1 gp41 Long Protein
Research Use Only
Recombinant Protein
E. coli
IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
Untagged
8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote