missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein
A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP12128-10ug
Additional Details : Gewicht : 0.01000kg
Spezifikation
Hepatitis B HBsAg preS1 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA | |
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
10 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Hepatitis B | |
Untagged | |
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl. |