missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein

A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12128-10ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15969458

  • 131.00 CHF / 10 Mikrogramm
Verfügbar ab: 26-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Spezifikation

Spezifikation

Hepatitis B HBsAg preS1 Protein
Research Use Only
Recombinant Protein
E. coli
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis B
Untagged
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl.
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote