Abnova™ PSENEN Recombinant Protein

Name: Abnova&trade; PSENEN Recombinant Protein
Brand: Abnova&trade;
SKU: 16131893
Price: 364.00 EUR

Marke: Abnova™ H00055851-P01.10ug

Additional Details : Gewicht : 0.00010kg

Artikelnummer. 16131893

Menge
Verfügbar ab: 03-05-2023
Sie sich ein, um den Lagerbestand zu sehen

Zum Warenkorb hinzufügen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Zugriffsnummer	AAH09575
Format	Solution
Gen-ID (Entrez)	55851
Name	PSENEN (Human) Recombinant Protein (P01)
Vorbereitungsmethode	In vitro wheat germ expression system
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Quelle	Wheat Germ (in vitro)
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gebräuchliche Bezeichnung	PSENEN
Kreuzreaktivität	Human
Rekombinant	Yes

Zur Verwendung mit (Anwendung)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Zusammensetzung	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molekulargewicht	36.85
pH-Bereich	8
Reinigungsverfahren	Glutathione Sepharose 4 Fast Flow
Menge	10 ug
Immunogen	MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Gen-Alias	MDS033/MSTP064/PEN-2/PEN2
Gensymbol	PSENEN
Wirtsspezies	Wheat Germ (in vitro)
Proteinmarkierung	GST

Beschreibung