missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPIL2 Antibody, R&D Systems™

PPIL2 Antibody, R&D Systems™

Codice prodotto. 18222012 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18222012 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18222012 Fornitore Novus Biologicals N. del fornitore NBP154366
 Articolo soggetto a restrizioni
Verfügbar ab: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PPIL2 Polyclonal specifically detects PPIL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigene PPIL2
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classificazione Polyclonal
Concentrazione 0.5 mg/ml
Coniugato Unconjugated
Diluizione Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulazione PBS, 2% Sucrose with 0.09% Sodium Azide
N. accesso geni Q13356
Alias gene CYC4, cyclophilin, 60kDa, cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, CYP60, EC 5.2.1.8, FLJ39930, hCyP-60, MGC33174, MGC787, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase-like 2, peptidylprolyl isomerase (cyclophilin)-like 2, PPIase, Rotamase PPIL2
Simboli geni PPIL2
Specie ospite Rabbit
Immunogeno Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Peso molecolare dell'antigene 59 kDa
Metodo di purificazione Affinity purified
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 23759
Ricostituzione Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.