missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ POLR2H (Human) Recombinant Protein
Human POLR2H full-length ORF ( AAH00739, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00005437-P01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Spezifikation
| AAH00739 | |
| polymerase (RNA) II (DNA directed) polypeptide H | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| POLR2H | |
| GST |
| 5437 | |
| Wheat germ expression system | |
| 25 μg | |
| RPABC3, RPB17, RPB8, hsRPB8 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |