missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PLXNA2 (Human) Recombinant Protein

Human PLXNA2 full-length ORF ( AAH32125, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005362-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16129231

  • 657.00 CHF / 25 Mikrogramm

Verfügbar ab: 12-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Spezifikation

Spezifikation

AAH32125
plexin A2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PLXNA2
GST
5362
Wheat germ expression system
25 μg
FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote