missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PLEKHA6 Recombinant Protein
Marke: Abnova™ H00022874-P01.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH10522.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 29.4 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| MHPRWAARLPLFISLLERADSVTAAYAKQH | |
| KIAA0969/MGC176733/PEPP3 | |
| PLEKHA6 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 22874 | |
| PLEKHA6 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PLEKHA6 | |
| Human | |
| Recombinant | |
| Solution |