missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PFN1 (Human) Recombinant Protein

Human PFN1 full-length ORF ( AAH06768, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005216-P01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16128981

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 06-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Spezifikation

Spezifikation

AAH06768
profilin 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
5216
Wheat germ expression system
10 μg
PFN1
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote