missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PDGFRA (Human) Recombinant Protein
Human PDGFRA full-length ORF ( AAH15186, 25 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00005156-P01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Spezifikation
| AAH15186 | |
| platelet-derived growth factor receptor, alpha polypeptide | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PDGFRA | |
| GST |
| 5156 | |
| Wheat germ expression system | |
| 10 μg | |
| CD140A, MGC74795, PDGFR2, Rhe-PDGFRA | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |