missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PDGFRA (Human) Recombinant Protein

Human PDGFRA full-length ORF ( AAH15186, 25 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00005156-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16128851

  • 657.00 CHF / 25 Mikrogramm

Verfügbar ab: 06-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Spezifikation

Spezifikation

AAH15186
platelet-derived growth factor receptor, alpha polypeptide
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PDGFRA
GST
5156
Wheat germ expression system
25 μg
CD140A, MGC74795, PDGFR2, Rhe-PDGFRA
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote