missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-68748
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
PAP2 Polyclonal antibody specifically detects PAP2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Spezifikation
| PAP2 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| lipid phosphate phosphatase-related protein type 5, phosphatidic acid phosphatase 2d, phosphatidic acid phosphatase type 2, PRG-5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 163404 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur