missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marke: Novus Biologicals NBP1-87547
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Muscarinic Acetylcholine Receptor M3/CHRM3 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M3/CHRM3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| Muscarinic Acetylcholine Receptor M3/CHRM3 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| cholinergic receptor, muscarinic 3, HM3, m3 muscarinic receptor, muscarinic acetylcholine receptor M3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CHRM3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV | |
| 0.1 mL | |
| GPCR | |
| 1131 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur