missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTUS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57447-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
MTUS1 Polyclonal specifically detects MTUS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| MTUS1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MTUS1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK | |
| 25 μL | |
| Breast Cancer | |
| 57509 | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur