Abnova™ MRPS17 Recombinant Protein

Name: Abnova&trade; MRPS17 Recombinant Protein
Brand: Abnova&trade;
SKU: 16129962
Price: 552.00 EUR

Marke: Abnova™ H00051373-P01.25ug

Additional Details : Gewicht : 0.00010kg

Artikelnummer. 16129962

Menge
Verfügbar ab: 04-05-2023
Sie sich ein, um den Lagerbestand zu sehen

Zum Warenkorb hinzufügen

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Zugriffsnummer	AAH54031
Format	Solution
Gen-ID (Entrez)	51373
Name	MRPS17 (Human) Recombinant Protein (P01)
Vorbereitungsmethode	In vitro wheat germ expression system
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Quelle	Wheat Germ (in vitro)
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gebräuchliche Bezeichnung	MRPS17
Kreuzreaktivität	Human
Rekombinant	Yes

Zur Verwendung mit (Anwendung)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Zusammensetzung	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molekulargewicht	40.04
pH-Bereich	8
Reinigungsverfahren	Glutathione Sepharose 4 Fast Flow
Menge	25 ug
Immunogen	MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ
Gen-Alias	HSPC011/MRP-S17/RPMS17
Gensymbol	MRPS17
Wirtsspezies	Wheat Germ (in vitro)
Proteinmarkierung	GST

Description