missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Mouse Pdgfb (homodimer) Recombinant Protein
Used for Func, SDS-PAGE
Marke: Abnova™ P4803.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Sequence: MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVTSpezifikation
P31240 | |
Lyophilized | |
24.6kDa | |
Escherichia coli expression system | |
MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT | |
RUO | |
PDGF-B/Sis | |
Pdgfb | |
E. coli | |
None | |
Lyophilized |
Functional Study, SDS-PAGE | |
18591 | |
Pdgfb/Pdgfb (Mouse) Recombinant Protein | |
10 μg | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
Pdgfb | |
The activity is determined by the dose-dependent proliferation in mouse 3T3 fibroblasts. The expected ED50 for this effect is 0.2-0.3ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Mouse Pdgfb (homodimer) Recombinant Protein > 10μg
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur