missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMR/CD206/Mannose Receptor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 8 publications
306.00 CHF - 691.00 CHF
Spezifikation
| Antigen | MMR/CD206/Mannose Receptor |
|---|---|
| Verdünnung | Western Blot 0.04-0.4 ug/ml, Flow Cytometry Validated for Flow from a verified customer review., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 28620274)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18465212
|
Novus Biologicals
NBP1-90020-25ul |
25 μL |
306.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18039625
|
Novus Biologicals
NBP1-90020 |
0.1 mL |
691.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
MMR/CD206/Mannose Receptor Polyclonal specifically detects MMR/CD206/Mannose Receptor in Human, Mouse, Porcine, Primate samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| MMR/CD206/Mannose Receptor | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4360 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Flow Cytometry Validated for Flow from a verified customer review., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 28620274)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Pig | |
| CD206, CLEC13Dmacrophage mannose receptor 1, C-type lectin domain family 13 member D, mannose receptor, C type 1, MMRCD206 antigen | |
| MRC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human MMR/CD206/Mannose Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts