missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SC65 Antibody - Azide and BSA Free, R&D Systems™

SC65 Antibody - Azide and BSA Free, R&D Systems™

Codice prodotto. 18611711 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18611711 0.1 mL 0.10mL
18678260 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18611711 Fornitore Novus Biologicals N. del fornitore NBP2946400.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Visualizzare prodotti alternativi

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SC65 Polyclonal antibody specifically detects SC65 in Human, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigene SC65
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS (pH 7.3), 50% glycerol
Alias gene leprecan-like 4, Leprecan-like protein 4, NO55, 55kDa, NOL55, Nucleolar autoantigen No55, SC65rat synaptonemal complex protein, synaptonemal complex protein SC65
Specie ospite Rabbit
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA
Metodo di purificazione Affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Cell Cycle and Replication
Primario o secondario Primary
ID gene (immissione) 10609
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.