missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAC1R Antibody, R&D Systems™

PAC1R Antibody, R&D Systems™

Codice prodotto. 18604368 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μg
25 μL
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18604368 100 μg 100µL
18699068 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18604368 Fornitore Novus Biologicals N. del fornitore NBP268620
  • ONLINE EXCLUSIVE PRICE
    641.35 CHF
    553.35 CHF / 100 Mikroliter
    Sparen 88.00 CHF
    13% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PAC1R Polyclonal antibody specifically detects PAC1R in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifica

Antigene PAC1R
Applicazioni Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulazione PBS (pH 7.2) and 40% Glycerol
Alias gene adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I, PACAP type I receptor, PACAP-R1, PACAP-R-1, PACAPRI, PACAPRPAC1, pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop, pituitary adenylate cyclase-activating polypeptide type I receptor
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Metodo di purificazione Protein A purified
Quantità 100 μg
Status giuridico RUO
Disciplina di ricerca Cancer, Cell Cycle and Replication, GPCR, Neuroscience, Neurotransmission, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 117
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.