missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARCH8. Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
542.00 CHF
Spezifikation
| Antigen | MARCH8. |
|---|---|
| Verdünnung | Western Blot 1.0 ug/ml |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18342484
|
Novus Biologicals
NBP3-09974-100UL |
100 μg |
542.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
44263 Polyclonal specifically detects 44263 in Human samples. It is validated for Western Blot.Spezifikation
| MARCH8. | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS buffer, 2% sucrose | |
| 220972 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Cellular modulator of immune recognition, EC 6.3.2, EC 6.3.2.-, MARCH-VIIIcellular modulator of immune recognition, membrane-associated ring finger (C3HC4) 8, Membrane-associated RING finger protein 8, Membrane-associated RING-CH protein VIII, MIR, RING finger protein 178 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8. Peptide sequence MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts