missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. COX7A1 Antibody - Azide and BSA Free, R&D Systems™

COX7A1 Antibody - Azide and BSA Free, R&D Systems™

Code produit 18603710 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité Unit Size
18603710 0.1 mL 0.10mL
18631621 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18603710 Supplier Novus Biologicals Supplier No. NBP2921850.1ml
 Article restreint
Verfügbar ab: 03-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

COX7A1 Polyclonal specifically detects COX7A1 in Human, Mouse, Rat samples. It is validated for ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigène COX7A1
Applications ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formule PBS with 50% glycerol, pH7.3.
Alias de gène COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1). MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cardiovascular Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 1346
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.