missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ LAMC1 (Human) Recombinant Protein

Abnova™ LAMC1 (Human) Recombinant Protein

Artikelnummer. p-7164417
Click to view available options
Menge:
10 μg
25 μg
missing translation for 'unitSize'
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy

Product Code. 16127311

missing translation for 'mfr': Abnova™ H00003915P01.10ug

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

Human LAMC1 full-length ORF ( AAH15586, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS

Specifications

Zugriffsnummer AAH15586
Gen-ID (Entrez) 3915
Name laminin, gamma 1 (formerly LAMB2)
Vorbereitungsmethode Wheat germ expression system
Qualitätskontrollen 125% SDS-PAGE Stained with Coomassie Blue
Menge 10 μg
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gen-Alias LAMB2, MGC87297
Gensymbol LAMC1
Spezies Wheat Germ (in vitro)
Proteinmarkierung GST
Puffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.