missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16108292

FGF21, Mouse, Clone: 1A8, Abnova™

Artikelnummer. 16108292
Ansicht ändern
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
16108292 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16108292 Lieferant Abnova Lieferanten-Nr. H00026291M02.100ug
  • ONLINE EXCLUSIVE PRICE
    373.00 CHF
    368.04 CHF / 100 Mikrogramm
    Sparen 4.96 CHF
    1% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 07-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse monoclonal antibody raised against a full-length recombinant FGF21.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Spezifikation

Antigen FGF21
Anwendungen ELISA, Immunoprecipitation, Western Blot
Klassifikation Monoclonal
Klon 1A8
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a full length recombinant FGF21.
Zusammensetzung PBS with no preservative; pH 7.4
Gen FGF21
Gen-Zugriffsnummer BC018404
Gensymbole FGF21
Wirtsspezies Mouse
Immunogen FGF21 (AAH18404, 30 a.a. ∼ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Unpurified
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 26291
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG1 κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.