missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KDM6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-87672
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
KDM6A Polyclonal specifically detects KDM6A in Human samples. It is validated for Western Blot.
Spezifikation
| KDM6A | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7403 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| bA386N14.2, bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX)), DKFZp686A03225, EC 1.14.11, EC 1.14.11.-, Histone demethylase UTX, lysine (K)-specific demethylase 6A, MGC141941, ubiquitously transcribed tetratricopeptide repeat protein X-linked, ubiquitously transcribed tetratricopeptide repeat, X chromosome, ubiquitously transcribed TPR protein on the X chromosome, ubiquitously transcribed X chromosome tetratricopeptide repeat protein, ubiquitously-transcribed TPR gene on the X chromosome, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein, UTXlysine-specific demethylase 6A | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human KDM6A. Peptide Sequence KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur