missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ISX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-79216-100UL
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ISX Polyclonal specifically detects ISX in Human samples. It is validated for Western Blot.
Spezifikation
| ISX | |
| Polyclonal | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| intestine-specific homeobox, RAXLX | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 91464 | |
| Human | |
| IgG |
| Western Blot | |
| LYOPH | |
| Western Blot 1:1000 | |
| NP_001008494 | |
| ISX | |
| Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. | |
| 100 μL | |
| Primary | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
RUO
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur