missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Isocitrate Dehydrogenase 1/IDH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
342.00 CHF - 582.00 CHF
Spezifikation
| Antigen | Isocitrate Dehydrogenase 1/IDH1 |
|---|---|
| Verdünnung | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000, Knockdown Validated |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18435101
|
Novus Biologicals
NBP1-87428-25ul |
25 μL |
342.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18464751
|
Novus Biologicals
NBP1-87428 |
0.1 mL |
582.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Isocitrate Dehydrogenase 1/IDH1 Polyclonal antibody specifically detects Isocitrate Dehydrogenase 1/IDH1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDownSpezifikation
| Isocitrate Dehydrogenase 1/IDH1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 3417 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000, Knockdown Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts