missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Inorganic Pyrophosphatase/PPA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-87788-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Inorganic Pyrophosphatase/PPA1 Polyclonal specifically detects Inorganic Pyrophosphatase/PPA1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| Inorganic Pyrophosphatase/PPA1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
| diphosphate phosphohydrolase, EC 3.6.1.1, inorganic diphosphatase, inorganic pyrophosphatase, inorganic pyrophosphatase 1, IOPPPMGC111556, PP1, PPase, PPcytosolic inorganic pyrophosphatase, pyrophosphatase (inorganic), pyrophosphatase (inorganic) 1, pyrophosphatase 1, Pyrophosphate phospho-hydrolase, SID6-8061 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPA1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK | |
| 25 μL | |
| metabolism, Signal Transduction | |
| 5464 | |
| Human, Mouse, Rat | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur