missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF323 Partial ORF (NP_112161.2, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00064288-Q01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16129596

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 13-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

ZNF323 is a member of the subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]).[supplied by OMIM]

Sequence: MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRR
Spezifikation

Spezifikation

NP_112161.2
Liquid
64288
ZNF323 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23407/ZNF20-Lp/ZNF310P/dJ874C20.2
ZNF323
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRR
RUO
ZNF323
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote