Learn More
Abnova™ Human ZC3HAV1 Partial ORF (NP_078901.3, 601 a.a. - 699 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00056829-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq]
Sequence: SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPESpezifikation
NP_078901.3 | |
Liquid | |
56829 | |
ZC3HAV1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp686F2052/DKFZp686H1869/DKFZp686O19171/FLB6421/FLJ13288/MGC48898/ZAP/ZC3H2/ZC3HDC2 | |
ZC3HAV1 | |
Yes | |
wheat germ expression system |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPE | |
RUO | |
ZC3HAV1 | |
Wheat Germ (in vitro) | |
GST |