missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human USP46 Partial ORF (NP_073743.2, 257 a.a. - 365 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00064854-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM]
Sequence: RFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRSpezifikation
| NP_073743.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSR | |
| RUO | |
| USP46 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 64854 | |
| USP46 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ11850/FLJ12552/FLJ14283/FLJ39393 | |
| USP46 | |
| Recombinant | |
| wheat germ expression system |