missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human TSPAN7 Partial ORF (NP_004606, 113 a.a. - 212 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16126755

Abnova™ Human TSPAN7 Partial ORF (NP_004606, 113 a.a. - 212 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16126755
25 ug, 25 Mikrogramm
Click to view available options
Menge:
10 ug
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16126755

Marke: Abnova™ H00007102Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
Alternative Produkte anzeigen

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq]

Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN

Spezifikation

Zugriffsnummer NP_004606
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 7102
Molekulargewicht 36.74kDa
Name TSPAN7 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 ug
Immunogen RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias A15/CCG-B7/CD231/DXS1692E/MRX58/MXS1/TALLA-1/TM4SF2/TM4SF2b
Gebräuchliche Bezeichnung TSPAN7
Gensymbol TSPAN7
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human TSPAN7 Partial ORF (NP_004606, 113 a.a. - 212 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt