missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TSEN2 Partial ORF (NP_079541, 366 a.a. - 465 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene
Sequence: LLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL
Spezifikation
Spezifikation
Zugriffsnummer | NP_079541 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 80746 |
Molekulargewicht | 36.74kDa |
Name | TSEN2 (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 10 μg |
Immunogen | LLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human TSEN2 Partial ORF (NP_079541, 366 a.a. - 465 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur