Learn More
Abnova™ Human TRPA1 Partial ORF (NP_015628, 1033 a.a. - 1117 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00008989-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq]
Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLSpezifikation
NP_015628 | |
Liquid | |
8989 | |
TRPA1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ANKTM1 | |
TRPA1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL | |
RUO | |
TRPA1 | |
Wheat Germ (in vitro) | |
GST |