missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TPD52 Partial ORF (NP_005070, 100 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00007163-Q01.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Sequence: SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESLSpezifikation
NP_005070 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL | |
RUO | |
TPD52 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7163 | |
TPD52 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
D52/N8L/PC-1/PrLZ/hD52 | |
TPD52 | |
Recombinant | |
wheat germ expression system |