missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TMEM68 Full-length ORF (AAH20835.1, 1 a.a. - 135 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00137695-P01.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Sequence: MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGKQGYFHLCVAIHVCCIGTVLPFHFIDSpezifikation
AAH20835.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
42.2kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ32370/MGC87778 | |
TMEM68 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
137695 | |
TMEM68 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGKQGYFHLCVAIHVCCIGTVLPFHFID | |
RUO | |
TMEM68 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |