missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human THRA Partial ORF (AAH02728, 87 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00007067-Q01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16126625

  • 361.00 CHF / 10 Mikrogramm
Verfügbar ab: 15-01-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST
Spezifikation

Spezifikation

AAH02728
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.86kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST
RUO
THRA
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
7067
THRA (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AR7/EAR7/ERB-T-1/ERBA/ERBA1/MGC000261/MGC43240/NR1A1/THRA1/THRA2/c-ERBA-1
THRA
Recombinant
wheat germ expression system
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote