Learn More
Abnova™ Human THOC2 Partial ORF (NP_065182.1, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00057187-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
THO2 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM]
Sequence: MFVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVISpezifikation
NP_065182.1 | |
Liquid | |
57187 | |
THOC2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CXorf3/THO2/dJ506G2.1 | |
THOC2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MFVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVI | |
RUO | |
THOC2 | |
Wheat Germ (in vitro) | |
GST |