missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TCF7L2 Partial ORF (NP_110383, 490 a.a. - 596 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
371.00 CHF - 561.00 CHF
Spezifikation
Zugriffsnummer | NP_110383 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 6934 |
Molekulargewicht | 37.51kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16136365
|
Abnova™
H00006934-Q01.25ug |
25 ug |
561.00 CHF
25 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
16126365
|
Abnova™
H00006934-Q01.10ug |
10 ug |
371.00 CHF
10 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes
Sequence: SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLESpezifikation
NP_110383 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.51kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TCF-4/TCF4 | |
TCF7L2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6934 | |
TCF7L2 (Human) Recombinant Protein (Q01) | |
SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE | |
RUO | |
TCF7L2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts