missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human STK11IP Partial ORF (NP_443134, 54 a.a. - 152 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00114790-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16151417

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
24-02-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS
Spezifikation

Spezifikation

NP_443134
Liquid
114790
STK11IP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA1898|LIP1|LKB1IP|STK11IP1
STK11IP
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS
RUO
STK11IP
wheat germ expression system
Yes
Videos
Dokumentation