missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SPEG (aa 1257-1326) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP92276
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53875 (PA5-53875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Spezifikation
| Q15772 | |
| Blocking Assay, Control | |
| 10290 | |
| 100 μL | |
| aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; APEG1; APEG-1; BPEG; CNM5; KIAA1297; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; SPEG; SPEG complex locus; SPEGalpha; SPEGbeta; striated muscle preferentially expressed protein kinase | |
| SPEG | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SPEG (aa 1257-1326) Control Fragment | |
| RUO | |
| SPEG | |
| Unconjugated | |
| Recombinant | |
| VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Invitrogen™ Human SPEG (aa 1257-1326) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur