missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human SOX2 Partial ORF (NP_003097, 155 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16125685
Verfügbar ab: 02-09-2025
Nur noch null auf Lager
Zum Warenkorb hinzufügen
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ Human SOX2 Partial ORF (NP_003097, 155 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SOX2 Partial ORF (NP_003097, 155 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16125685
10 µg, 10 Mikrogramm
Click to view available options
Menge:
10 µg
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16125685

Marke: Abnova™ H00006657Q01.10ug

Nur noch null auf Lager
Verfügbar ab: 02-09-2025
Zum Warenkorb hinzufügen
Nur noch null auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Used for AP, Array, ELISA, WB-Re

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq]

Sequence: QRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVK

Spezifikation

Zugriffsnummer NP_003097
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 6657
Molekulargewicht 35.75kDa
Name SOX2 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 µg
Immunogen QRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVK
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias ANOP3/MCOPS3/MGC2413
Gebräuchliche Bezeichnung SOX2
Gensymbol SOX2
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human SOX2 Partial ORF (NP_003097, 155 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt