Learn More
Abnova™ Human SMARCAL1 Partial ORF (NP_054859, 491 a.a. - 599 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00050485-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency. [provided by RefSeq]
Sequence: FTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPSpezifikation
NP_054859 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.73kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
FTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKP | |
RUO | |
SMARCAL1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
50485 | |
SMARCAL1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HARP/HHARP | |
SMARCAL1 | |
Recombinant | |
wheat germ expression system |